Awe touring exhaust b8 s4. $1600 for the whole setup.
Awe touring exhaust b8 s4 Does anyone have any experience running… 2008-2016 Audi S4 / S5 B8 / B8. I am weighing my options of selling the car as-is, versus paying my shop to swap the stock exhaust back onto it and selling the AWE system. 0T - Diamond Black Tips (102mm) 3010-43012 parts at JEGS. The Touring Edition Exhaust removes the factory valving and replaces it with AWE’s 180 Technology drone-cancelling resonators (and electronic valve simulators). 5) equipped with the AWE Touring Exhaust and AWE Non-Resonated Downpipes. (B8. 0T systems have paved the way for future exhaust technologies that can now be found in most every AWE Tuning ® exhaust product. AWE Touring Edition Exhaust - B8/B8. Shop Now at the Guaranteed Lowest Price! $5 off $49 / $15 off $249 / $30 off $499 / $65 off $999* - Use Promo Code: SAVE Comparison between an AWE Touring Edition Exhaust for the Audi B8. Equipped with the same precision-engineering as its Touring Edition counterpart, minus the 180 Technology resonators in the rear. $1300 obo. In this video, I show you guys how I installed the AWE Touring Edition Exhaust system on my Supercharged 2010 Audi B8 S4 Quattro 6 Speed Manual! It is not th AWE Tuning Exhaust System Kit - AWE Touring Edition for Audi B8 S4 3. 034Motorsport is pleased to offer the AWE Tuning B8/B8. 5 S4 to the original retail purchaser (Consumer) against manufacturer’s defects as follows: ONE (1) YEAR on exhaust tip finish, LIFETIME on balance of parts, from purchase date from AWE directly or from an AWE authorized retailer. 0T - Chrome Silver Tips (102mm) (SKU: 3010-42016) 034Motorsport is pleased to offer the AWE Tuning B8/B8. 2016 Audi S4 with New Carbon Fiber ECS Kohlefaser Luft-Technik Intake and AWE Touring Edition Exhaust. 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket Feb 25, 2015 · 2010 Audi S4 DSG. Compatible with the Sedan and Avant, the AWE Tuning A4 Touring Edition Exhaust and Downpipe rise to the occasion of unlocking performance. (AWE) warrants this Touring Edition exhaust system and/or Downpipe for the 2010-2016 Audi B8 / B8. E. and No to CEL. Secor Ltd. Presenting the AWE Exhaust Suite for the Audi C8 S6/S7 2. 0T - Chrome Silver Tips (102mm) 3010-42016 parts at JEGS. Enhance your Audi B8 S4 3. This video captures the pure exterior and interior sound of a 2015 Audi S4 (B8. I have a set of AWE resonated downpipes ready to install if I decide this is too loud, or drones. 0T systems have paved the way for future exhaust technologies that can now be found in most every AWE exhaust product. zps123, I've been working on the garage for awhile. 00 USD Black Diamond 90mm Tips - $1,695. 0T Remarkably civil while idling/part throttle cruising, but unleashed at full throttle produces what some have called a “war-cry wail. 0T - for 90mm Tips AWE Touring Edition Exhaust B8 / B8. Planning on purchasing an AWE touring exhaust, but worried about too much drone with stock downpipes and DSG. Featuring AWE 180 Technology Gains of 8 Crank HP and 9 Crank TQ Direct Bolt On Does not effect or alter any emissions devices, completely street legal Available with 90mm AWE Touring Edition Exhaust for Audi B8 S4 3. Signature AWE howl, delivered. Yes bolt on. 0T (Mfg#AWEB8S4TK) fits Audi B8 S4 3. Remarkably civil while idling/part throttle cruising, but unleashed at full throttle produces what some have called a war-cry wail. 5 Audi S4. ⏳ Promotion ends in: AWE Touring-to-Track Conversion Kit for B8/8. 0T Coupe. Sound waves, carried by these exhaust gasses, bounce off the walls of the reflection chambers. Shop Now at the Guaranteed Lowest Price! $5 off $49 / $20 off $249 / $60 off $499 / $120 off $999* - Use Promo Code: SALE Get the Best Performance with AWE Exhaust & Tuning Touring Edition Exhaust for Audi B8 S4 3. The exhaust is in good condition and was on my car for a little less than a year. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c Get the Best Performance with AWE Exhaust & Tuning AWE Track-to-Touring Conversion Kit for B8. 0T - Chrome. 5 S4/S5 3. This AWE AWE Touring Edition Exhaust System - Audi B8. That being said, I have had non-res, stock and resonated downpipes all mated with the AWE touring on my last B8. AWE Tuning has been countless hours researching and developing th AWE Touring Edition Exhaust for B8. Our Audi A4 2. 5" piping and continues back to the center muffler and finally the rear mufflers ending in quad Diamond Black 102 mm slash cut exhaust tips with the AWE Tuning logo. It would be a local sale only in southeast PA or surrounding area. 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket . 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket Touring Edition: Perfect tone, compliments of AWE 180 Technology® As exhaust gases exit the 3. This system replaces the restrictive factory exhaust system from behind the catalytic converters all the way back to quad 90mm exhaust tips. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c Part of the AWE S5 Exhaust Family; Product Filters. 0T at the best online prices at eBay! Free shipping for many products! AWE Tuning A4 B8 2. This system will produce a Oct 14, 2012 · I am getting ready to sell my beloved B8. 0L SC Track to Touring Exhaust Conversion Kit by AWE Got the Track Edition and want to convert to Touring to "turn it down" a little? Check out AWE's Touring Conversion Kit. Not only does it deliver a thrilling auditory experience, but it also guarantees optimal performance through its innovative design. This AWE lineup represents the finest in 3. Get the Best Performance with AWE Exhaust & Tuning Touring-to-Track Edition Conversion Kit for B8. Shop Now at the Guaranteed Lowest Price! JEGS Friends & Family Presidents' Day Savings Today I'm going to be discussing my thoughts and opinions on the AWE Tuning Touring Edition Exhaust for the B8/B8. Apr 10, 2024 · Find many great new & used options and get the best deals for AWE Tuning Exhaust System Kit - AWE Touring Edition Exhaust for Audi B8 S4 3. Aug 22, 2021 · I installed an AWE touring exhaust on my 2011 B8 S4 about 10 years ago. 5 S4 (2010-2016). ” Features AWE's proprietary 180 Technology® resonators. These are just my thoughts and e AWE Touring Edition Exhaust for B8/B8. com/ Tell them I sent you! _____Add me on Snapchat! Username: eruben123Follow IgnitionTube on Instagram and Tw The AWE Tuning 3010-43012 Exhaust is a T-304 stainless steel, mandrel bent, downpipe-back system. 0T - Chrome Silver Tips (90mm) 3010-42018 parts at JEGS. From resonated to non-resonated, there’s a performance option for every type of Audi S4 3. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c AWE Touring Edition Exhaust for Audi B8 S4 3. Clear. 5 midnight blue ** awe res exhaust res dp's quad black diamond tips ** injen intake ** Touring Edition Exhausts were designed for the sophisticated enthusiast that wants to improve the stock exhaust note of their Audi B8 S4 without upsetting the neighbors or making the ride too noisy for some passengers (significant others, clients, kids, or maybe grandma). This AWE AWE Track Edition Exhaust System - B8/B8. Learn more about AWE Sep 25, 2018 · B8 S4; AWE Touring Exhaust Tips 90mm vs 102mm; Results 1 to 24 of 24 APR Open Intake, APR CPS, AWE Touring Exhaust (90mm Silver), KW HAS, 034 Rear Sway, 034 Mount It is this intensive attention to detail that sets AWE Tuning ® exhaust products heads and shoulders above the rest. AWE Touring Edition Exhaust for Audi B8 S4 3. 0T Chrome Silver Tips (102mm) Featuring AWE 180 Technology; Gains of 8 hp and 9 lb-ft of torque to the crank; Direct bolt-on; This AWE lineup represents the finest in 3. 0T | 3815 Sep 28, 2021 · 2015 Audi S4 6MT l Glacier White Metallic l 034 Motorsport Stage 2+ E40 Tuned l APR Supercharger Pulley l 034 190mm Crank Pulley l MercRacing HX l Autotech HPFP l HRE FF01 l Michelin Pilot Sport 4S 255-35-19 l JHM Racepipes l Custom Catted Downpipes w/ Vibrant Turbo Flex Pipes l AWE Tuning Touring Exhaust w/ Vibrant Resonators l USP Stainless Feb 7, 2025 · Get the Best Performance with AWE Exhaust & Tuning AWE Track-to-Touring Conversion Kit for B8/8. 2011 S4 prestige. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c Apr 20, 2012 · Selling an AWE Touring Exhaust with 90mm quad silver tips and Resonated downpipes. Have Touring and want to go Track Edition? No problem, we have a conversion kit for that, too! Features Proudly AWE Touring Edition Exhaust System - B8/B8. 0T exhaust system represents the most comprehensive exhaust development project in our company history. 0T - Diamond Black Tips (90mm) 2X Entries For Our 8Y RS3 Sweepstakes! Mfg Part # 3010-43014 ECS Part # ES# 4043428 AWE Touring Edition Exhaust System - B8/B8. Featuring AWE 180 Technology® Max gains of 8 hp and 9 ft-lbs of torque at the c AWE Touring Edition Exhaust for Audi B9 S4 - Diamond Black 102mm Tips (SKU: 3010-43050) Fitment guarantee AWE was born in 1991 as an installer of aftermarket parts. 90 mm Tips Jun 10, 2014 · The Track Edition Exhaust is a new, lower priced addition to their existing catalog of B8 and B8. STOCK DOWNPIPES. Guaranteed fitment and performance with a lifetime warranty. The 3. From the rowdy Track Edition to the sophisticated Touring Edition to resonated or non-resonated downpipes, there’s a performance option for every type of Audi S4 3. 0TFSI Touring Edition Exhaust This AWE Tuning lineup represents the finest in 3. 0T (Mfg#AWEB8S4TR) fits Audi B8 S4 3. Featuring AWE 180 Technology Gains of 8 Crank HP and 9 Crank TQ Direct Bolt On Does not effect or alter any emissions devices, completely street legal Available with 90mm Touring Edition Exhaust Systems by AWE Tuning Our 3. System Type: Cat Back. Jan 16, 2025 · Audi B8 S4 3. 0T driver. This system will produce a louder tone in the mid range. AWE prides itself on having the best sounding exhausts in the world and they delivered with a drone free, melodic sounding system for your B8/8. Sep 13, 2016 · Available with large diameter oval tips (polished or matte black) or quad tips, this exhaust system looks great on almost any S4. 0T - for 102mm Tips 3815-41010 parts at JEGS. Handcrafted, every detail drives toward maximum performance, quality and perfect sound. 5 | S4 | S5 | 3. Featuring AWE Tuning 180 Technology; Max gains of 8 hp and 9 ft-lbs of torque at the crank ; Direct bolt-on AWE Touring Edition Exhaust for B8 A4 2. 0T (Mfg#AWEB85S530TR) fits Audi B8 S5 3. 0T and the factory exhaust configuration, courtesy of Matt Biro. I have 6000 miles on it, so it has been broken in for a while. From resonated to non-resonated, there’s a performance option for every type of 3. Boasting a free flowing design over the OEM exhaust unit, this AWE Touring Edition Exhaust System - B8/B8. 00 Chrom Silver 90mm Tips - $1,595. All and all, this S4 looks outstanding and we’re glad to be the shop Michael knows he can trust with his S4. 0T. 9TT: 50-state emissions-compliant dual 3” catback exhausts Options include Touring and Track Editions Touring Editions feature AWE’s patented drone-canceling 180 Technology® Dyno-proven gains of +9 hp and Our B8 S4 exhaust system is capped off with attractive 90mm slash cut tips featuring the AWE Tuning logo. UPC: 810098800761. So far I think it sounds great, not too loud and hasn't droned yet. 0T - Diamond Black Tips (90mm) 3010-43014 parts at JEGS. 0T - for 90mm Tips 3815-41008 parts at JEGS. Jan 10, 2025 · The 3. 5 S4. 0T - for 102mm Tips 3820-41008 parts at JEGS. 0T engine and flow into an AWE 180 Technology® equipped resonator, they pass through strategically located ports, and into reflection chambers. From Resonated to Non, there's a performance option for every type of 3. 0T-3. 0T has been waiting for from AWE Tuning Brox Tuning is proud to offer the AWE Tuning Touring Exhaust system for the B8/B8. 0T Touring Edition Exhaust. The Touring Edition is the sophisticated member of the B9 S4 exhaust family. Nov 21, 2012 · 2012 S4 black, prestige, titanium, sport diff ** stasis tune ** kw street comfort coilovers ** vmr v701 19x9. 5 S5 3. 5 Allroad - Dual Outlet, Chrome Silver Tips (SKU: 3015-32016) Fitment guarantee AWE was born in 1991 as an installer of aftermarket AWE Tuning's Research and Development department spends countless hours designing each exhaust system they produce. 10-22 Apr 4, 2011 · B8 S4; Awe touring exhaust owners; Results 1 to 24 of 24 Thread: Awe touring exhaust owners. Handcrafted in-house, these systems command respect while remaining sophisticated, refined, and powerful, all at once. These tips are double walled to ensure a mirror finish even under hard usage. 0TFSI Touring Edition ExhaustThis AWE Tuning lineup represents the finest in 3. 0T - Single Side, Chrome Silver Tips (SKU: 3015-22010) Fitment guarantee AWE was born in 1991 as an installer of Mar 12, 2010 · If anyone here is left still on their stock exhaust and considering the AWE Touring then read on. AWE Track-to-Touring Conversion Kit - Audi B8/B8. AWE Touring is very tame and you'll only ever hear a rasp when you stomp it down to WOT because that's just how their system is designed to run at that throttle position, but at cruising speeds or even low rpm you won't hear anything. 0T - Single Side, Diamond Black Tips - 3015-23010 Rating Required Select Rating 1 star (worst) 2 stars 3 stars (average) 4 stars 5 stars (best) Aug 5, 2010 · So I had an AWE Touring exhaust with the resonated downpipes professionally installed in late March 2020 and loved it until about one month ago when a drone became noticeable in the 1200 - 1800 rpm range when under load. 0T exhausts have earned praise from owners and the press alike, due to their unique "Jekyll and Hyde" personality. Find AWE Tuning Touring Edition Exhaust Systems and get Free Shipping on Orders Over $109 at Summit Racing! AWE Tuning Touring Edition exhaust systems deliver a bolt-on design with AWE's proprietary straight-through drone-canceling solution--180 Technology that cancels out problematic frequencies, leaving only unlocked performance and AWE's signature note. 5 over a period of a few months. 0T - for 102mm Tips Audi S5|S4 2013-2017 is an absolute must. 0T equipped Audi S4. Enjoy and watch in HD! This AWE lineup represents the finest in 3. The possibility of rattling is eliminated with the addition of AWE Tuning downpipes. This AWE line up represents the finest in 3. Shop Now at the Guaranteed Lowest Price! $5 off $49 / $15 off $249 / $30 off $499 / $65 off $999* - Use Promo Code: SAVE AWE Tuning Audi S4 B8 3. This AWE lineup represents the finest in 3. Conversion kits are SPECIFICALLY designed to convert an existing AWE exhaust system. 5 S4 exhaust systems. The difference comes in the removal of AWE Tuning’s sound-cancelling 180 Technology™ rear-mufflers, which can be found on our Touring Edition Exhaust. Featuring AWE 180 Technology. 0T at the best online prices at eBay! Free shipping for many products! The lower priced sibling of our renowned Touring Edition Exhaust, the Track Edition is made of the same quality 304 stainless, is crafted in house, and delivers the same power gains. 0T exhaust technology. This video shows the AWE Tuning Touring Exhaust with OEM DP during a cold start, city driving, and freeway merging. Notes: In limited cases, the factory downpipes have been known to emit minor rattling noises when paired with the AWE Tuning S4 exhaust system. With everything installed, Michael’s Audi S4 looks hotter than ever. 5 S4/S5. 5 Audi S4 is also available. Interchange Part Number: AWE_3010-43014. 0T at the best online prices at eBay! Free shipping for many products! Aug 20, 2013 · This thread will serve as my comprehensive (and ongoing) review of the AWE Tuning exhaust system installed on my 2012 S4 6MT. 5 3. 00 USD Chrome Silver 102mm Tips - $1,795. Dec 23, 2024 · AWE Tuning AWE Touring Edition Exhaust for Audi B8 S4 3. AWE spent considerable time and effort during development to achieve remarkable civility when idling and at part throttle cruising, while also producing a war-cry wail when full throttle is applied. The difference comes in the removal of AWE's sound-cancelling 180 Technology™ rear-mufflers, which can be found on our Touring Edition Exhaust. 5 Audi S4, which have set the standard in B8 and B8. Featuring AWE 180 Technology® Gains of 8 hp and 9 ft-lbs of torque to the crank Direct bolt-on Does not affect or alter any emissions devices, completely 50 sta Dec 16, 2024 · AWE Tuning AWE Touring Edition Exhaust for Audi B8 S4 3. “The Track Edition Exhaust features the same quality 304 stainless Apr 2, 2024 · Find many great new & used options and get the best deals for AWE Touring Exhaust for 10-16 Audi B8 S4 3. 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket Touring Edition Exhaust The best just got better. Fits both the B8 and B8. We have spent considerable tim Nov 19, 2024 · Get the Best Performance with AWE Exhaust & Tuning Touring Edition Exhaust for Audi B8 S4 3. Love the exhaust. The AWE Tuning exhaust begins after the factory downpipes with 2. Thread Tools. AWE Tuning also offers Touring Edition Exhaust Systems for both the B8 Audi S4 and B8. The difference comes in the removal of AWE Tuning’s sound-cancelling 180 Technology™ rear-muf Get the Best Performance with AWE Exhaust & Tuning Touring Edition Exhaust for Audi B8 S4 3. I started a different thread ~3 weeks ago to spark some discussion about any negative aspects of the exhaust system (which was very helpful in my decision ultimately to purchase it), but I did not want my actual post-purchase review to get buried in there. 5 Audi S4 Touring Edition Exhaust with 90mm Chrome Silver Tips. 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket If you're looking for a "no rasp" system you'll want to look at a Milltek system or even a Scorpion system. 5 S4 Regular price $1,595. 5 S4 which currently has an AWE Touring exhaust with resonated downpipes and diamond black 90mm tips. LEE25. For those looking to transform their Audi's exhaust system, the AWE Touring-to-Track Edition Conversion Kit for B8. 5) equipped with the AWE Touring AWE Touring Edition Exhaust for Audi B8 S4 3. 0T - Chrome Silver Tips. Shop Now at the Guaranteed Lowest Price! $5 off $49 / $15 off $249 / $30 off $499 / $65 off $999* - Use Promo Code: SAVE AWE Tuning Audi S4 B8. Presenting the AWE Exhaust Suite for the BMW G87 M2: 50-state emissions-complaint dual 3” exhaust configuration Available as valved SwitchPath™ or rowdy Track Edition Optional non-resonated performance mid-pipes available separately SwitchPath™ incorporates AWE’s drone-canceling 180 Technology®, and This AWE line up represents the finest in 3. Sep 3, 2017 · Check out UroTuning: https://www. AWE Exhausts and Downpipes for Audi B8 S4 This AWE lineup represents the finest in 3. 5 S4 3. 00 USD This AWE lineup represents the finest in 3. Feb 6, 2019 · 2015 Audi S4 6MT l Glacier White Metallic l 034 Motorsport Stage 2+ E40 Tuned l APR Supercharger Pulley l 034 190mm Crank Pulley l MercRacing HX l Autotech HPFP l HRE FF01 l Michelin Pilot Sport 4S 255-35-19 l JHM Racepipes l Custom Catted Downpipes w/ Vibrant Turbo Flex Pipes l AWE Tuning Touring Exhaust w/ Vibrant Resonators l USP Stainless Steel Clutch Line Kit l Southbend Stage 3 Endurance Compact powerhouse. 0T - Diamond Black Tips (102mm) (SKU: 3010-43012) Fitment guarantee AWE was born in 1991 as an installer of aftermarket Apr 16, 2024 · Find many great new & used options and get the best deals for AWE Tuning Exhaust System Kit - AWE Touring Edition Exhaust for Audi B8 S4 3. Feb 2, 2005 · AWE Touring exhaust with the OEM stock downpipes. Imola 6mt. 0T - Chrome Silver Tips (90mm) Audi S4 2010-2016 | 3010-42018 Apr 10, 2024 · Find many great new & used options and get the best deals for AWE Tuning Exhaust System Kit - AWE Touring Edition Exhaust for Audi B8 S4 3. Shop Now at the Guaranteed Lowest Price! JEGS Friends & Family Presidents' Day Savings This AWE line up represents the finest in 3. Show Printable Version; 08-02-2018 07:20 AM #1. urotuning. It has polished 102mm tips. These sophisticated, more civilized B8 S4 with AWE Touring Exhaust. The Exhaust your B8/B8. Coming from a B7 S4 Avant 6MT where I went through three different systems in my attempt to make more power, open up the V8 sound and keep the drone to a normal level the B8 S4 is obviously completely different. This system replaces the restrictive factory exhaust system from behind the catalytic converters all the way back to quad 90mm exhaust tips. Local pick-up in SoCal (Los Angeles) area not interested in shipping. Nov 1, 2016 · Hey all, Just purchased my dream car two weeks ago, 2013 Audi S4 DSG, Estoril Crystal Blue! Thought the exhaust sounded too anemic and couldn't wait to mod it so I installed an AWE Touring exhaust with 102mm polished tips last weekend. Shop Now at the Guaranteed Lowest Price! $5 off $49 / $15 off $249 / $30 off $499 / $65 off $999* - Use Promo Code: SAVE Jun 12, 2023 · Selling my AWE Touring exhaust for the B8. 0T with the AWE Touring Edition Exhaust featuring 90mm Chrome Silver tips. Track Edition Exhaust Systems by AWE Tuning The lower priced sibling of our renowned Touring Edition Exhaust, the Track Edition is made of the same quality 304 stainless, is crafted in house, and delivers the same power gains. Edition: Touring Edition. Get the Best Performance with AWE Exhaust & Tuning Touring Edition Exhaust for Audi B8 S4 3. Jan 28, 2015 · The polished 102mm tips of the AWE Tuning Cat-Back Exhaust for B8 Audi S4 are also available on the TRACK Edition of the AWE B8 S4 Exhaust. 5 Audi S4 3. Experience +8 hp and +9 lb-ft of torque with a sophisticated sound profile. Like AWE, Milltek also offers their Cat-Back Exhaust for B8 Audi S4 in resonated and non-resonated forms, and Milltek updated the system as the Milltek Cat Back Exhaust for B8. We feel this is the best exhaust system out there today for the 3. 5 S4 exhaust tone. This AWE AWE Touring Edition Exhaust System - B8/B8. $1600 for the whole setup. 00 USD Black Diamont 102mm Tips - $1,895. 5 A4 2. Choose between the classic Polished Silver slash cut tips, our luscious Diamond Black slash cut tips, or our distinctive Diamond Black oval shaped tips to help This AWE lineup represents the finest in 3. 5" Black Tips at the best online prices at eBay! Free shipping for many products! Jun 27, 2012 · On this platform exhaust doesn’t appear to do much despite claims, as some of the fastest guys On the forums have had stock exhausts. bwfgncdkitcefdgcfgqtsacryqghkfwoyjqrwwpfmkinkckmhibwrkkvdvkbxqcujkjkcwbp